Atlas Antibodies Anti-SYPL2 Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human SYPL2 (synaptophysin like 2). Affinity purified using PrEST antigen. Suitable for ICC and other immunoassays. Provided in PBS with glycerol and sodium azide preservative.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SYPL2 Antibody
Target: synaptophysin like 2 (SYPL2)
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
- Other immunoassay applications
Product Description
Polyclonal antibody against human SYPL2.
Alternative Gene Names
- Mg29
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | synaptophysin like 2 |
| Target Gene | SYPL2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000027887 (78%), Rat ENSRNOG00000019780 (78%) |
Antigen Sequence:
FKETPWHGQGQGQDQDQDQDQGQGPSQESAAEQGAVE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.