CacheBy
Atlas Antibodies Anti-SYPL2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SYPL2 Antibody

상품 한눈에 보기

Rabbit polyclonal antibody targeting human SYPL2 (synaptophysin like 2). Affinity purified using PrEST antigen. Suitable for ICC and other immunoassays. Provided in PBS with glycerol and sodium azide preservative.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA076657-100 Anti-SYPL2 Antibody, synaptophysin like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076657-25 Anti-SYPL2 Antibody, synaptophysin like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SYPL2 Antibody

Anti-SYPL2 Antibody

Target: synaptophysin like 2 (SYPL2)
Supplier: Atlas Antibodies

  • Immunocytochemistry (ICC)
  • Other immunoassay applications

Product Description

Polyclonal antibody against human SYPL2.

Alternative Gene Names

  • Mg29

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein synaptophysin like 2
Target Gene SYPL2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000027887 (78%), Rat ENSRNOG00000019780 (78%)

Antigen Sequence:
FKETPWHGQGQGQDQDQDQDQGQGPSQESAAEQGAVE

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.