
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SYPL2 Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human SYPL2 (synaptophysin like 2). Affinity purified using PrEST antigen. Suitable for ICC and other immunoassays. Provided in PBS with glycerol and sodium azide preservative.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA076657-100 Anti-SYPL2 Antibody, synaptophysin like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076657-25 Anti-SYPL2 Antibody, synaptophysin like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SYPL2 Antibody
Anti-SYPL2 Antibody
Target: synaptophysin like 2 (SYPL2)
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
- Other immunoassay applications
Product Description
Polyclonal antibody against human SYPL2.
Alternative Gene Names
- Mg29
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | synaptophysin like 2 |
| Target Gene | SYPL2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000027887 (78%), Rat ENSRNOG00000019780 (78%) |
Antigen Sequence:
FKETPWHGQGQGQDQDQDQDQGQGPSQESAAEQGAVE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



