
Atlas Antibodies Anti-SYCP3 Antibody
상품 한눈에 보기
Human SYCP3 단백질에 특이적인 폴리클로날 항체로, IHC를 통한 단백질 발현 정밀 검증에 적합. Rabbit에서 유래된 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. PBS/glycerol 완충액에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SYCP3 Antibody
Target: synaptonemal complex protein 3 (SYCP3)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human SYCP3.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | synaptonemal complex protein 3 |
| Target Gene | SYCP3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat (78%, ENSRNOG00000005270), Mouse (78%, ENSMUSG00000020059) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SYDE1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SYCP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SYCP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SYDE2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SYCP2L Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.