CacheBy
Atlas Antibodies Anti-STXBP6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STXBP6 Antibody

상품 한눈에 보기

Human STXBP6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 분석에 적합. Orthogonal validation으로 단백질 발현 검증 완료. 고순도 Affinity purified 제품으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074869-100 Anti-STXBP6 Antibody, syntaxin binding protein 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074869-25 Anti-STXBP6 Antibody, syntaxin binding protein 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STXBP6 Antibody

Anti-STXBP6 Antibody

Target: syntaxin binding protein 6 (amisyn)
Type: Polyclonal Antibody against Human STXBP6

  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody raised in rabbit against human STXBP6 (syntaxin binding protein 6, also known as amisyn).

Alternative Gene Names

amisyn, HSPC156

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein syntaxin binding protein 6 (amisyn)
Target Gene STXBP6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence NKKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLK
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000046314 (99%), Rat ENSRNOG00000004198 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.