
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-STXBP6 Antibody
상품 한눈에 보기
Human STXBP6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 분석에 적합. Orthogonal validation으로 단백질 발현 검증 완료. 고순도 Affinity purified 제품으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA074869-100 Anti-STXBP6 Antibody, syntaxin binding protein 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074869-25 Anti-STXBP6 Antibody, syntaxin binding protein 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-STXBP6 Antibody
Anti-STXBP6 Antibody
Target: syntaxin binding protein 6 (amisyn)
Type: Polyclonal Antibody against Human STXBP6
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody raised in rabbit against human STXBP6 (syntaxin binding protein 6, also known as amisyn).
Alternative Gene Names
amisyn, HSPC156
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | syntaxin binding protein 6 (amisyn) |
| Target Gene | STXBP6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NKKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000046314 (99%), Rat ENSRNOG00000004198 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



