
Atlas Antibodies Anti-STXBP6 Antibody
상품 한눈에 보기
Human STXBP6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 분석에 적합. Orthogonal validation으로 단백질 발현 검증 완료. 고순도 Affinity purified 제품으로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-STXBP6 Antibody
Target: syntaxin binding protein 6 (amisyn)
Type: Polyclonal Antibody against Human STXBP6
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody raised in rabbit against human STXBP6 (syntaxin binding protein 6, also known as amisyn).
Alternative Gene Names
amisyn, HSPC156
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | syntaxin binding protein 6 (amisyn) |
| Target Gene | STXBP6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NKKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000046314 (99%), Rat ENSRNOG00000004198 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-STXBP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STXBP5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STXBP6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STXBP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STXBP4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.