
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-STOML1 Antibody
상품 한눈에 보기
Human STOML1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC에 적합. PrEST 항원으로 친화 정제. 40% 글리세롤 및 PBS 완충액, 0.02% sodium azide 포함. 인간에 반응하며 마우스 및 랫과 높은 상동성.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042353-100 Anti-STOML1 Antibody, stomatin (EPB72)-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042353-25 Anti-STOML1 Antibody, stomatin (EPB72)-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-STOML1 Antibody
Anti-STOML1 Antibody
Target: stomatin (EPB72)-like 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Recombinant expression validation using target protein overexpression
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human STOML1.
Alternative Gene Names
FLJ36370, hUNC-24, SLP-1, STORP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | stomatin (EPB72)-like 1 |
| Target Gene | STOML1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLEINDVTRA |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000032333 (95%)
- Rat ENSRNOG00000008530 (94%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



