CacheBy
Atlas Antibodies Anti-STOML1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STOML1 Antibody

상품 한눈에 보기

Human STOML1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC에 적합. PrEST 항원으로 친화 정제. 40% 글리세롤 및 PBS 완충액, 0.02% sodium azide 포함. 인간에 반응하며 마우스 및 랫과 높은 상동성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042353-100 Anti-STOML1 Antibody, stomatin (EPB72)-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042353-25 Anti-STOML1 Antibody, stomatin (EPB72)-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STOML1 Antibody

Anti-STOML1 Antibody

Target: stomatin (EPB72)-like 1
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry)
  • WB (Western Blot) — Recombinant expression validation using target protein overexpression
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human STOML1.

Alternative Gene Names

FLJ36370, hUNC-24, SLP-1, STORP

Open Datasheet

Target Information

항목 내용
Target Protein stomatin (EPB72)-like 1
Target Gene STOML1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLEINDVTRA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000032333 (95%)
  • Rat ENSRNOG00000008530 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Tooltip Recombinant Expression
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.