CacheBy
Atlas Antibodies Anti-SSR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SSR1 Antibody

상품 한눈에 보기

Human SSR1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. 독립적 검증으로 높은 특이성과 신뢰성을 보장하며, PrEST 항원을 이용해 친화 정제되었습니다. Human, Mouse, Rat에서 반응성이 확인되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011276-100 Anti-SSR1 Antibody, signal sequence receptor, alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011276-25 Anti-SSR1 Antibody, signal sequence receptor, alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SSR1 Antibody

Anti-SSR1 Antibody

Target: signal sequence receptor, alpha (SSR1)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot) – Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human SSR1


Alternative Gene Names

  • TRAPA

Target Information

항목 내용
Target Protein signal sequence receptor, alpha
Target Gene SSR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000014165 (100%)
  • Mouse ENSMUSG00000021427 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Validation
WB Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.