
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SSR1 Antibody
상품 한눈에 보기
Human SSR1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. 독립적 검증으로 높은 특이성과 신뢰성을 보장하며, PrEST 항원을 이용해 친화 정제되었습니다. Human, Mouse, Rat에서 반응성이 확인되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA011276-100 Anti-SSR1 Antibody, signal sequence receptor, alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011276-25 Anti-SSR1 Antibody, signal sequence receptor, alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SSR1 Antibody
Anti-SSR1 Antibody
Target: signal sequence receptor, alpha (SSR1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot) – Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human SSR1
Alternative Gene Names
- TRAPA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | signal sequence receptor, alpha |
| Target Gene | SSR1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000014165 (100%)
- Mouse ENSMUSG00000021427 (98%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



