
Atlas Antibodies Anti-SRP54 Antibody
상품 한눈에 보기
Human SRP54 단백질에 특이적인 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 연구 응용에 적합. 40% glycerol 기반 buffer로 안정적 보관 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SRP54 Antibody
Target: Signal Recognition Particle 54kDa (SRP54)
Type: Polyclonal Antibody against Human SRP54
Recommended Applications
- Immunohistochemistry (IHC)
- 기타 응용은 사용자가 조건을 최적화해야 함
Product Description
Polyclonal antibody raised in rabbit against human SRP54 protein.
Affinity purified using recombinant PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Signal recognition particle 54kDa |
| Target Gene | SRP54 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | SALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNV |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000032776 (100%)
- Mouse ENSMUSG00000079108 (100%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Composition
40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 환경에 맞게 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
