CacheBy
Atlas Antibodies Anti-SRM Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SRM Antibody

상품 한눈에 보기

Human SRM 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 재조합 발현 단백질 기반으로 검증됨. 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015746-100 Anti-SRM Antibody, spermidine synthase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015746-25 Anti-SRM Antibody, spermidine synthase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SRM Antibody

Anti-SRM Antibody

Target: Spermidine synthase (SRM)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)
  • ICC (Immunocytochemistry)

Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against human SRM (spermidine synthase).
Validated for multiple applications with recombinant expression confirmation.

Alternative Gene Names

  • SPS1
  • SRML1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Spermidine synthase
Target Gene SRM
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEF
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000046379 (92%), Mouse ENSMUSG00000006442 (91%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.