Thermo Fisher Scientific PC4 Polyclonal Antibody
PC4 단백질을 인식하는 토끼 폴리클로날 항체로, Western blot, IHC, Flow Cytometry 등 다양한 응용에 적합. 고순도 항원 친화 크로마토그래피 정제. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. 인체, 마우스, 랫트 반응성.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human PC4 (C-terminus, 96–127aa: MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747199 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
PC4 (Activated RNA Polymerase II Transcription Cofactor 4) is a transcriptional coactivator with DNA-binding activity. It can suppress promoter-driven and nonspecific transcription. This repression is alleviated by transcription factor TFIIH, which protects promoters from PC4-mediated repression through the ERCC3 helicase activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Synaptopodin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SCP3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PC4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific STS Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific STRA8 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|