원본
Thermo Fisher Scientific PC4 Polyclonal Antibody
상품 한눈에 보기
PC4 단백질을 인식하는 토끼 폴리클로날 항체로, Western blot, IHC, Flow Cytometry 등 다양한 응용에 적합. 고순도 항원 친화 크로마토그래피 정제. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. 인체, 마우스, 랫트 반응성.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 28. 오전 10:19
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA580084 PC4 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific PC4 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human PC4 (C-terminus, 96–127aa: MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747199 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
PC4 (Activated RNA Polymerase II Transcription Cofactor 4) is a transcriptional coactivator with DNA-binding activity. It can suppress promoter-driven and nonspecific transcription. This repression is alleviated by transcription factor TFIIH, which protects promoters from PC4-mediated repression through the ERCC3 helicase activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Synaptopodin Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SCP3 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific STS Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific STRA8 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.