
Atlas Antibodies Anti-SPINK5 Antibody
상품 한눈에 보기
Human SPINK5 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 실험에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. PrEST 항원을 이용해 Affinity purification 되었으며, 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPINK5 Antibody
Serine peptidase inhibitor, Kazal type 5
Recommended Applications
- IHC (Orthogonal validation)
- ICC
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SPINK5
Alternative Gene Names
DKFZp686K19184, FLJ21544, FLJ97536, FLJ97596, FLJ99794, LEKTI, LETKI, NETS, NS, VAKTI
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Serine peptidase inhibitor, Kazal type 5 |
| Target Gene | SPINK5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DGRLGCTRENDPVLGPDGKTHGNKCAMCAELFLKEAENAKREGETRIRRNAEKDFCKEYEKQVRNGRLFCTRESDPVRGPDGRMHGNKCALCAEIFKQRFSEENSKTDQN |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000055561 (77%), Rat ENSRNOG00000048953 (74%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPINK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPINK13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPINK5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPINK6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPINK9 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.