Atlas Antibodies Anti-SPERT Antibody

상품 한눈에 보기

인간 SPERT 단백질을 인식하는 폴리클로날 항체로, 정자세포 관련 단백질 연구에 적합합니다. IHC 및 ICC에 사용 가능하며, RNA-seq 데이터 기반 직교 검증을 거쳤습니다. 토끼 유래 IgG 항체로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040046-100 Anti-SPERT Antibody, spermatid associated 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040046-25 Anti-SPERT Antibody, spermatid associated 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

spermatid associated

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human SPERT

CBY2, NURIT

항목	내용
Target Protein	spermatid associated
Target Gene	SPERT
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	NKALREENRMLSKENKILQVFWEEHKASLGREESRAPSPLLHKDSASLEVVKKDHVALQVPRGKEDSTLQLLREENRALQQLLEQKQAY

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand