CacheBy
Atlas Antibodies Anti-SPEG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPEG Antibody

상품 한눈에 보기

Human SPEG 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. SPEG complex locus를 타깃으로 하며 RNA-seq 데이터와 비교한 단백질 발현 검증에 적합. 고순도 Affinity 정제 및 안정한 보존용액 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018904-100 Anti-SPEG Antibody, SPEG complex locus 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018904-25 Anti-SPEG Antibody, SPEG complex locus 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPEG Antibody

Anti-SPEG Antibody

Target Information

  • Target Protein: SPEG complex locus
  • Target Gene: SPEG
  • Alternative Gene Names: APEG1, BPEG, KIAA1297, MGC12676, SPEGalpha, SPEGbeta

Product Description

Polyclonal antibody against Human SPEG.

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    VYKSVIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTYTVQHQV

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000019850 99%
Mouse ENSMUSG00000026207 97%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.