Atlas Antibodies Anti-SPEF2 Antibody

상품 한눈에 보기

Human SPEF2 단백질을 인식하는 토끼 폴리클로날 항체로, 정자 편모 단백질 연구에 적합합니다. IHC 및 RNA-seq 데이터 비교를 통한 직교 검증 완료. 고순도 친화정제 제품이며, 다양한 종에서 교차 반응성이 확인되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040343-100 Anti-SPEF2 Antibody, sperm flagellar 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040343-25 Anti-SPEF2 Antibody, sperm flagellar 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: sperm flagellar 2 (SPEF2)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human SPEF2.

CT122, FLJ23577, KPL2

항목	내용
Target Protein	sperm flagellar 2
Target Gene	SPEF2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	VPQPPKPGSEEWVYVNEPVPEEMPLFLVPYWELIENSYINTIKTVLRHLREDQHTVLAYLYEIRTSFQEFLKRPDHKQDFVAQWQ
Verified Species Reactivity	Human
Interspecies Homology	Mouse (82%), Rat (78%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand