Atlas Antibodies Anti-SPERT Antibody

상품 한눈에 보기

인간 SPERT 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. RNA-seq 데이터 기반 정교한 정합 검증을 거쳤으며, 토끼에서 생산된 IgG 형식의 항체입니다. 고순도 친화정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039359-100 Anti-SPERT Antibody, spermatid associated 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039359-25 Anti-SPERT Antibody, spermatid associated 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

spermatid associated

IHC (Immunohistochemistry) – Orthogonal validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human SPERT

CBY2, NURIT

항목	내용
Target Protein	spermatid associated
Target Gene	SPERT
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	NKALREENRMLSKENKILQVFWEEHKASLGREESRAPSPLLHKDSASLEVVKKDHVALQVPRGKEDSTLQLLREENRALQQLLEQKQAY

항목	내용
Verified Species Reactivity	Human
Interspecies Information	Highest antigen sequence identity to the following orthologs: Rat ENSRNOG00000047413 (71%) Mouse ENSMUSG00000034913 (71%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand