CacheBy
Atlas Antibodies Anti-SPACA5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPACA5 Antibody

상품 한눈에 보기

인간 SPACA5 단백질을 인식하는 토끼 다클론 항체로, 정자 아크로좀 관련 단백질 연구에 적합합니다. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원으로 특이 정제되었습니다. 인간 반응성이 검증된 고품질 연구용 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047149-100 Anti-SPACA5 Antibody, sperm acrosome associated 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047149-25 Anti-SPACA5 Antibody, sperm acrosome associated 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPACA5 Antibody

Anti-SPACA5 Antibody

Target: Sperm Acrosome Associated 5 (SPACA5)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human SPACA5 protein.


Alternative Gene Names

dJ54B20.3, LYC5, LYZL5, PNPK6288, SLLP2, UNQ6288

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Sperm Acrosome Associated 5
Target Gene SPACA5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MDCHDLLNRHILDDIRCAKQIVSSQNGLSAWTSWRLHC
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000045622 (68%), Mouse ENSMUSG00000037167 (63%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.