
Atlas Antibodies Anti-SPACA5 Antibody
상품 한눈에 보기
인간 SPACA5 단백질을 인식하는 토끼 다클론 항체로, 정자 아크로좀 관련 단백질 연구에 적합합니다. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원으로 특이 정제되었습니다. 인간 반응성이 검증된 고품질 연구용 항체입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPACA5 Antibody
Target: Sperm Acrosome Associated 5 (SPACA5)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human SPACA5 protein.
Alternative Gene Names
dJ54B20.3, LYC5, LYZL5, PNPK6288, SLLP2, UNQ6288
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Sperm Acrosome Associated 5 |
| Target Gene | SPACA5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MDCHDLLNRHILDDIRCAKQIVSSQNGLSAWTSWRLHC |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000045622 (68%), Mouse ENSMUSG00000037167 (63%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SP9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPA17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPACA5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPACA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPACA1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.