CacheBy
Atlas Antibodies Anti-SOHLH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SOHLH1 Antibody

상품 한눈에 보기

인간 SOHLH1 단백질을 인식하는 폴리클로날 항체로, 정자 및 난자 발생 관련 연구에 적합함. 토끼 유래 IgG로 PrEST 항원 친화 정제. 인간 반응성 검증 완료. 40% 글리세롤 및 PBS 버퍼에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059439-100 Anti-SOHLH1 Antibody, spermatogenesis and oogenesis specific basic helix-loop-helix 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059439-25 Anti-SOHLH1 Antibody, spermatogenesis and oogenesis specific basic helix-loop-helix 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SOHLH1 Antibody

Anti-SOHLH1 Antibody

Target: Spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1)
Type: Polyclonal Antibody against Human SOHLH1


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting the human SOHLH1 protein, involved in spermatogenesis and oogenesis.


Alternative Gene Names

bA100C15.3, bHLHe80, C9orf157, NOHLH, SPATA27, TEB2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Spermatogenesis and oogenesis specific basic helix-loop-helix 1
Target Gene SOHLH1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PWSLDPASASPEPVPHILASSRQWDPASCTSLGTDKCEALLGLCQVRGGLPPFSEPSSLVPWPPGRSLPKAVRP

Species Reactivity

항목 내용
Verified Reactivity Human
Interspecies Identity Rat ENSRNOG00000016254 (32%), Mouse ENSMUSG00000029546 (30%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.