
Atlas Antibodies Anti-SOHLH1 Antibody
상품 한눈에 보기
인간 SOHLH1 단백질을 인식하는 폴리클로날 항체로, 정자 및 난자 발생 관련 연구에 적합함. 토끼 유래 IgG로 PrEST 항원 친화 정제. 인간 반응성 검증 완료. 40% 글리세롤 및 PBS 버퍼에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SOHLH1 Antibody
Target: Spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1)
Type: Polyclonal Antibody against Human SOHLH1
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody targeting the human SOHLH1 protein, involved in spermatogenesis and oogenesis.
Alternative Gene Names
bA100C15.3, bHLHe80, C9orf157, NOHLH, SPATA27, TEB2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Spermatogenesis and oogenesis specific basic helix-loop-helix 1 |
| Target Gene | SOHLH1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PWSLDPASASPEPVPHILASSRQWDPASCTSLGTDKCEALLGLCQVRGGLPPFSEPSSLVPWPPGRSLPKAVRP |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000016254 (32%), Mouse ENSMUSG00000029546 (30%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
