
Atlas Antibodies Anti-SNX29 Antibody
상품 한눈에 보기
Human SNX29 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. FLJ12363, RUNDC2A 대체 유전자명으로도 알려짐. 인간에 대해 검증된 반응성을 가짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SNX29 Antibody
Target Protein: Sorting Nexin 29 (SNX29)
Type: Polyclonal Antibody against Human SNX29
Recommended Applications
- IHC (Immunohistochemistry)
Product Description
Polyclonal antibody raised in rabbit against human SNX29.
Alternative gene names: FLJ12363, RUNDC2A
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
QGVSSLFREITASSAVSILIKPEQETDPLPVVSRNVSADAKCKKERKKKKKVTNIISFDDEEDEQNSGDVFKKTPGAGESSEDNSDRSSVNIMSAFESPFGPNS
Species Reactivity
| Species | Reactivity | Identity (%) |
|---|---|---|
| Human | Verified | - |
| Rat | Predicted | 76 |
| Mouse | Predicted | 75 |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Preservative | Sodium azide (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SNX24 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SNX30 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SNX29 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SNX29 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SNX20 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.