CacheBy
Atlas Antibodies Anti-SNU13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNU13 Antibody

상품 한눈에 보기

Human SNU13 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성을 보여 마우스와 랫에서도 반응합니다. 40% 글리세롤 기반 PBS 버퍼에 보존제가 포함되어 있습니다.

카탈로그번호
HPA029199-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029199-100 Anti-SNU13 Antibody, SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029199-25 Anti-SNU13 Antibody, SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNU13 Antibody

Anti-SNU13 Antibody

SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human SNU13.

Alternative Gene Names

15.5K, FA-1, NHP2L1, SNRNP15-5, SPAG12, SSFA1

Open Datasheet

Target Information

항목 내용
Target Protein SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5)
Target Gene SNU13
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERL
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000063480 (100%), Rat ENSRNOG00000025154 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.