CacheBy
Atlas Antibodies Anti-SNTN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNTN Antibody

상품 한눈에 보기

Human SNTN 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 데이터와의 정합으로 정교한 직교 검증이 가능합니다. Human에 특이적 반응을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA058399-100 Anti-SNTN Antibody, sentan, cilia apical structure protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058399-25 Anti-SNTN Antibody, sentan, cilia apical structure protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNTN Antibody

Anti-SNTN Antibody

Target: sentan, cilia apical structure protein
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SNTN


Alternative Gene Names

FLJ44379, S100AL

Open Datasheet


Target Information

항목 내용
Target Protein sentan, cilia apical structure protein
Target Gene SNTN
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLE
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000044772 (70%), Rat ENSRNOG00000027383 (63%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.