Atlas Antibodies Anti-SNTN Antibody

상품 한눈에 보기

Human SNTN 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 데이터와의 정합으로 정교한 직교 검증이 가능합니다. Human에 특이적 반응을 보입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058399-100 Anti-SNTN Antibody, sentan, cilia apical structure protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058399-25 Anti-SNTN Antibody, sentan, cilia apical structure protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: sentan, cilia apical structure protein
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human SNTN

FLJ44379, S100AL

항목	내용
Target Protein	sentan, cilia apical structure protein
Target Gene	SNTN
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	HSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLE
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000044772 (70%), Rat ENSRNOG00000027383 (63%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand