AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SNTN Antibody
상품 한눈에 보기
Human SNTN 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 실험에 최적화되어 있습니다. RNA-seq 데이터와의 직교 검증을 통해 신뢰성 높은 발현 확인이 가능합니다. PrEST 항원을 이용해 친화 정제되었으며, 휴먼 시료에 반응합니다.
- 카탈로그번호
- HPA043322-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043322-100 Anti-SNTN Antibody, sentan, cilia apical structure protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043322-25 Anti-SNTN Antibody, sentan, cilia apical structure protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SNTN Antibody
Anti-SNTN Antibody
Target: sentan, cilia apical structure protein
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human SNTN.
Alternative Gene Names
FLJ44379, S100AL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | sentan, cilia apical structure protein |
| Target Gene | SNTN |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | HSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000044772 (70%), Rat ENSRNOG00000027383 (63%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 설명 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도와 조건은 사용자가 실험 환경에 맞게 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.