CacheBy
Atlas Antibodies Anti-SNW1 Antibody
원본

Atlas Antibodies Anti-SNW1 Antibody

상품 한눈에 보기

인간 SNW1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 토끼에서 생산된 IgG 항체이며, 친화 정제 방식으로 고순도 확보. 인간, 마우스, 랫트에 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA017370-100 Anti-SNW1 Antibody, SNW domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017370-25 Anti-SNW1 Antibody, SNW domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNW1 Antibody

Anti-SNW1 Antibody

Target Information

  • Target Protein: SNW domain containing 1
  • Target Gene: SNW1
  • Alternative Gene Names: Bx42, NCoA-62, Prp45, PRPF45, SKIIP, SKIP
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SNW1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKF

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000021039 99%
Rat ENSRNOG00000037998 98%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

References

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.