CacheBy
Atlas Antibodies Anti-SNRPA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNRPA Antibody

상품 한눈에 보기

Human SNRPA 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. 높은 종간 보존성을 가지며, PrEST 항원을 사용해 친화 정제되었습니다. 40% glycerol/PBS buffer에 보존되어 안정적인 실험 결과를 제공합니다.

카탈로그번호
HPA054834-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054834-100 Anti-SNRPA Antibody, small nuclear ribonucleoprotein polypeptide A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054834-25 Anti-SNRPA Antibody, small nuclear ribonucleoprotein polypeptide A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNRPA Antibody

Anti-SNRPA Antibody

Target: small nuclear ribonucleoprotein polypeptide A
Type: Polyclonal Antibody against Human SNRPA


  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Product Description

Polyclonal antibody raised in rabbit against the human SNRPA protein (small nuclear ribonucleoprotein polypeptide A).


Alternative Gene Names

Mud1, U1-A, U1A

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein small nuclear ribonucleoprotein polypeptide A
Target Gene SNRPA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000001501 (95%), Mouse ENSMUSG00000061479 (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.