
Atlas Antibodies Anti-SNN Antibody
상품 한눈에 보기
Human SNN 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC Orthogonal Validation을 통해 검증됨. Recombinant PrEST 항원을 이용해 정제되었으며, Human, Mouse, Rat 종에 높은 반응성을 보임. 연구용으로 단백질 발현 분석에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SNN Antibody
Target Protein: stannin
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SNN
Open Datasheet
Antigen Information
- Target Gene: SNN
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
EDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEV
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000037972 | 95% |
| Rat | ENSRNOG00000058739 | 95% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SNPH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SNRNP200 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SNN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SNIP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SNED1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.