CacheBy
Atlas Antibodies Anti-SNN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNN Antibody

상품 한눈에 보기

Human SNN 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC Orthogonal Validation을 통해 검증됨. Recombinant PrEST 항원을 이용해 정제되었으며, Human, Mouse, Rat 종에 높은 반응성을 보임. 연구용으로 단백질 발현 분석에 적합.

카탈로그번호
HPA011055-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011055-100 Anti-SNN Antibody, stannin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011055-25 Anti-SNN Antibody, stannin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNN Antibody

Anti-SNN Antibody

Target Protein: stannin
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SNN
Open Datasheet

Antigen Information

  • Target Gene: SNN
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    EDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEV

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000037972 95%
Rat ENSRNOG00000058739 95%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.