CacheBy
Atlas Antibodies Anti-SMS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SMS Antibody

상품 한눈에 보기

인간 SMS(spermine synthase)를 표적으로 하는 고품질 폴리클로날 항체입니다. IHC 및 WB 실험에 적합하며, 재조합 단백질 발현 검증을 거쳤습니다. Rabbit 유래 IgG 항체로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA029852-100 Anti-SMS Antibody, spermine synthase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029852-25 Anti-SMS Antibody, spermine synthase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SMS Antibody

Anti-SMS Antibody

Target: spermine synthase
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human SMS

Alternative Gene Names

MRSR, SPMSY, SpS, SRS

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein spermine synthase
Target Gene SMS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000007688 (99%), Mouse ENSMUSG00000071708 (97%)

Antigen Sequence:
GDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPE

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.