Atlas Antibodies Anti-SMIM12 Antibody

상품 한눈에 보기

Human SMIM12 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. PBS/glycerol buffer에 보존제로 sodium azide 포함.

카탈로그번호: HPA065331-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA065331-100 Anti-SMIM12 Antibody, small integral membrane protein 12 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA065331-25 Anti-SMIM12 Antibody, small integral membrane protein 12 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SMIM12 Antibody

Anti-SMIM12 Antibody

Target Information

Target Protein: small integral membrane protein 12
Target Gene: SMIM12
Alternative Gene Names: C1orf212, FLJ90372

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SMIM12.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000014352 (97%)
Mouse ENSMUSG00000042380 (95%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand