CacheBy
Atlas Antibodies Anti-SMC6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SMC6 Antibody

상품 한눈에 보기

인간 SMC6 단백질을 인식하는 토끼 폴리클로날 항체로, 염색체 구조 유지 단백질 연구에 적합. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공.

카탈로그번호
HPA042733-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042733-100 Anti-SMC6 Antibody, structural maintenance of chromosomes 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042733-25 Anti-SMC6 Antibody, structural maintenance of chromosomes 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SMC6 Antibody

Anti-SMC6 Antibody

Target Information

  • Target Protein: Structural maintenance of chromosomes 6
  • Target Gene: SMC6
  • Alternative Gene Names: FLJ22116, SMC6L1

Product Description

Polyclonal antibody against human SMC6, designed for applications in immunohistochemistry and related assays.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000004908 84%
Mouse ENSMUSG00000020608 81%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.
  • Immunohistochemistry (IHC)

Open Datasheet (PDF)

제품 이미지

Recommended Applications: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.