
Atlas Antibodies Anti-FERMT1 Antibody
상품 한눈에 보기
Human FERMT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 Affinity 정제됨. 고순도 IgG 형식으로 제공되며, PBS와 glycerol buffer에 보존됨. 인간 FERMT1 연구용으로 검증된 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FERMT1 Antibody
Target Information
- Target Protein: fermitin family member 1
- Target Gene: FERMT1
- Alternative Gene Names: C20orf42, FLJ20116, KIND1, UNC112A, URP1
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal Antibody against Human FERMT1.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
DSSYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKKHKSKQLA
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000021274 (85%)
- Mouse ENSMUSG00000027356 (85%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-FES Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FERMT3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FERMT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FERD3L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FER1L6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.