
Atlas Antibodies Anti-FBXO9 Antibody
상품 한눈에 보기
인간 FBXO9 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG입니다. WB 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤/PBS 버퍼에 보존되어 안정적입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FBXO9 Antibody
Target: F-box protein 9 (FBXO9)
Type: Polyclonal Antibody against Human FBXO9
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human FBXO9 protein.
Alternative gene names: FBX9, NY-REN-57
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | F-box protein 9 |
| Target Gene | FBXO9 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PDIIWVFPPQAEAEEDCHSDTVRADDDEENESPAETDLQAQLQMFRAQWMFELAPGVSSSNLENRPCRAARGSLQKTSADTKGKQE |
Species Reactivity
| 종 | Antigen Sequence Identity |
|---|---|
| Human | Verified |
| Mouse | 66% (ENSMUSG00000001366) |
| Rat | 66% (ENSRNOG00000008214) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-FBXW11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FBXW11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FBXO9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FBXO8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FBXO6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.