
Atlas Antibodies Anti-FAM187B Antibody
상품 한눈에 보기
Human FAM187B 단백질에 특이적인 폴리클로날 항체로, IHC를 통한 단백질 발현 Orthogonal 검증에 적합. Rabbit 유래 IgG 형식이며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, 높은 특이도와 재현성을 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FAM187B Antibody
Target: family with sequence similarity 187 member B (FAM187B)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human FAM187B.
Alternative Gene Names
FLJ25660, TMEM162
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | family with sequence similarity 187 member B |
| Target Gene | FAM187B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DNFRLDEKTEFVWLDCPLGSMYRPVNWRANDTPLTWESQLSGQDFTTFLDPSTGGRQLQVFQPAVYKCFVQQELVAQFKPAASLETLE |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Interspecies Identity | Rat ENSRNOG00000021060 (56%), Mouse ENSMUSG00000046826 (51%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-FAM189A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM189A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM187B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM187A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM186B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.