
Atlas Antibodies Anti-FAM168B Antibody
상품 한눈에 보기
인간 FAM168B 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. Rabbit 유래 IgG 항체이며 PrEST 항원으로 정제됨. 높은 종간 서열 동일성(97%)을 보여 신뢰성 높은 결과 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FAM168B Antibody
family with sequence similarity 168, member B
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human FAM168B
Alternative Gene Names
KIAA0280L
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | family with sequence similarity 168, member B |
| Target Gene | FAM168B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSP |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000037503 (97%)
- Rat ENSRNOG00000023467 (97%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-FAM170A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM168B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM168B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM168A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM167B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.