
원본
Thermo Fisher Scientific ARL13A Polyclonal Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human ARL13A C-terminal region. Validated for Western blot at 1 µg/mL. Supplied as a liquid, affinity purified, and stored in PBS with sucrose and sodium azide. For research use only.
- 카탈로그번호
- PA546396
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오후 03:41
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA546396 ARL13A Polyclonal Antibody 100 ul pk판매 단위 pk
재고 1개
630,500원VAT 포함 693,550원
Thermo Fisher Scientific · Thermo Fisher Scientific ARL13A Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the C-terminal of human ARL13A (aa 192–241) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2607521 |
Product Specific Information
- Peptide Sequence: TCQLPPTSSISISKNNTGSGERCSSHSFSTRTGMSKEKRQHLEQCSIEAK
- Sequence Homology:
- Human: 100%
- Pig: 77%
- Rabbit: 85%
Target Information
The function of this protein remains unknown.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
