
Thermo Fisher Scientific ARL13A Polyclonal Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human ARL13A C-terminal region. Validated for Western blot at 1 µg/mL. Supplied as a liquid, affinity purified, and stored in PBS with sucrose and sodium azide. For research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the C-terminal of human ARL13A (aa 192–241) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2607521 |
Product Specific Information
- Peptide Sequence: TCQLPPTSSISISKNNTGSGERCSSHSFSTRTGMSKEKRQHLEQCSIEAK
- Sequence Homology:
- Human: 100%
- Pig: 77%
- Rabbit: 85%
Target Information
The function of this protein remains unknown.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific COPZ1 Polyclonal Antibody
630,500원

Thermo Fisher Scientific
Thermo Fisher Scientific XAGE1 Polyclonal Antibody
630,500원

Thermo Fisher Scientific
Thermo Fisher Scientific ARL13A Polyclonal Antibody
630,500원

Thermo Fisher Scientific
Thermo Fisher Scientific FAM212B Polyclonal Antibody
630,500원

Thermo Fisher Scientific
Thermo Fisher Scientific C4orf50 Polyclonal Antibody
630,500원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.