
Atlas Antibodies Anti-FAM126B Antibody
Human FAM126B 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합합니다. FAM126B/HYCC2 유전자 연구용으로 사용되며, PrEST 항원으로 친화 정제되었습니다. 인체 및 마우스 반응성이 검증되었습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FAM126B Antibody
Target: family with sequence similarity 126, member B (FAM126B)
Type: Polyclonal Antibody against Human FAM126B
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Product Description
Polyclonal antibody raised in rabbit against the human FAM126B protein. Suitable for detection of FAM126B in human and mouse samples.
Alternative Gene Names
HYCC2, MGC39518
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | family with sequence similarity 126, member B |
| Target Gene | FAM126B |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | PFDAPDSTQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGVNGGEESVNLNDADEGFSSGASLSSQPIGTKPSSSS |
Verified Species Reactivity
- Human
- Mouse
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000025079 (94%)
- Mouse ENSMUSG00000038174 (93%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-FAM129A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM129A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM126B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM129A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FAM126B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|