Atlas Antibodies Anti-FAH Antibody
Atlas Antibodies의 Anti-FAH 항체는 인간 FAH 단백질을 표적으로 하는 토끼 폴리클로날 IgG 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, Orthogonal 및 Independent validation을 통해 신뢰성 검증이 완료되었습니다. Affinity purified 방식으로 높은 특이성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-FAH Antibody
Anti-FAH Antibody
fumarylacetoacetate hydrolase (fumarylacetoacetase)
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC
Suitable for immunocytochemistry applications.
Product Description
Polyclonal Antibody against Human FAH
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | fumarylacetoacetate hydrolase (fumarylacetoacetase) |
| Target Gene | FAH |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000013223 (88%), Mouse ENSMUSG00000030630 (88%) |
Antigen Sequence:
INLSVNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGD
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.