CacheBy
Atlas Antibodies Anti-ERFE Antibody
원본

Atlas Antibodies Anti-ERFE Antibody

상품 한눈에 보기

인체 ERFE 단백질을 인식하는 폴리클로날 항체로, 면역염색 등 다양한 연구용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화정제되었습니다. 사람에 대해 검증되었으며, 마우스 및 랫트와 교차반응 가능성이 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077259-100 Anti-ERFE Antibody, erythroferrone 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077259-25 Anti-ERFE Antibody, erythroferrone 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ERFE Antibody

Anti-ERFE Antibody

Target Information

  • Target Protein: erythroferrone
  • Target Gene: ERFE
  • Alternative Gene Names: C1QTNF15, CTRP15, FAM132B, FLJ37034
  • Antigen Sequence:
    EPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGP

Product Description

Polyclonal antibody against human ERFE (erythroferrone).

  • Immunocytochemistry (ICC)

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000024688): 79%
  • Mouse (ENSMUSG00000047443): 74%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.