
Atlas Antibodies Anti-EPB41L5 Antibody
상품 한눈에 보기
Human EPB41L5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 재조합 발현 검증을 통해 높은 특이성과 신뢰성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-EPB41L5 Antibody
Target: erythrocyte membrane protein band 4.1 like 5 (EPB41L5)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human EPB41L5, validated for multiple applications including immunohistochemistry (IHC), western blot (WB), and immunocytochemistry (ICC).
Recombinant expression validation in WB using target protein overexpression.
Alternative Gene Names
BE37, FLJ12957, KIAA1548, YMO1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | erythrocyte membrane protein band 4.1 like 5 |
| Target Gene | EPB41L5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LLASLTENLIDHTVAPQVSSTSMITPRWIVPQSGAMSNGLAGCEMLLTGKEGHGNKDGISLISPPAPFLVDAVTS |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000002538 (76%), Mouse ENSMUSG00000026383 (73%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, recombinant expression validation)
- Immunocytochemistry (ICC)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-EPB41L5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPB42 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPB41L5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPB41L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EPB41 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.