AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ENPP4 Antibody
상품 한눈에 보기
Human ENPP4 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity 정제되어 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용에 적합하며, PBS 기반 buffer에 sodium azide 보존제가 포함되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA016594-100 Anti-ENPP4 Antibody, ectonucleotide pyrophosphatase/phosphodiesterase 4 (putative) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016594-25 Anti-ENPP4 Antibody, ectonucleotide pyrophosphatase/phosphodiesterase 4 (putative) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ENPP4 Antibody
Anti-ENPP4 Antibody
Target: ectonucleotide pyrophosphatase/phosphodiesterase 4 (putative)
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against Human ENPP4, produced in rabbit.
Alternative Gene Names
- KIAA0879
- NPP4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ectonucleotide pyrophosphatase/phosphodiesterase 4 (putative) |
| Target Gene | ENPP4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQW |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000010174 (88%), Mouse ENSMUSG00000023961 (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험에 맞게 조정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.