AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ENPP1 Antibody
상품 한눈에 보기
Human ENPP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 연구용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 반응하며 Mouse, Rat과 91% 서열 유사성 보유. 안정화용 글리세롤 및 PBS 버퍼 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062066-100 Anti-ENPP1 Antibody, ectonucleotide pyrophosphatase/phosphodiesterase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062066-25 Anti-ENPP1 Antibody, ectonucleotide pyrophosphatase/phosphodiesterase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ENPP1 Antibody
Anti-ENPP1 Antibody
Target: ectonucleotide pyrophosphatase/phosphodiesterase 1 (ENPP1)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC) 등 다양한 응용에 사용 가능
Product Description
Polyclonal Antibody against Human ENPP1
Alternative Gene Names
M6S1, NPPS, PC-1, PCA1, PDNP1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ectonucleotide pyrophosphatase/phosphodiesterase 1 |
| Target Gene | ENPP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC |
Verified Species Reactivity
Human
Interspecies Information
| Species | Ortholog ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000013994 | 91% |
| Mouse | ENSMUSG00000037370 | 91% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자 실험 환경에 따라 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.