
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ENPP2 Antibody
상품 한눈에 보기
인간 ENPP2 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광 등 다양한 응용에 적합. PrEST 항원을 이용해 친화정제됨. 높은 종간 보존성으로 인간, 마우스, 랫트에 반응. 글리세롤 보존 용액으로 안정적 장기 보관 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053652-100 Anti-ENPP2 Antibody, ectonucleotide pyrophosphatase/phosphodiesterase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053652-25 Anti-ENPP2 Antibody, ectonucleotide pyrophosphatase/phosphodiesterase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ENPP2 Antibody
Anti-ENPP2 Antibody
Target: ectonucleotide pyrophosphatase/phosphodiesterase 2 (ENPP2)
Type: Polyclonal Antibody against Human ENPP2
Recommended Applications
- Immunocytochemistry (ICC)
- Other standard immunoassays (user optimization required)
Product Description
Polyclonal antibody raised in rabbit against human ENPP2, also known as ectonucleotide pyrophosphatase/phosphodiesterase 2.
Alternative Gene Names
ATX, PD-IALPHA, PDNP2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ectonucleotide pyrophosphatase/phosphodiesterase 2 |
| Target Gene | ENPP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence (aa) | TNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLT |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to:
- Mouse (ENSMUSG00000022425): 94%
- Rat (ENSRNOG00000004089): 92%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



