
Atlas Antibodies Anti-ENKUR Antibody
Human ENKUR 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증 완료. Orthogonal validation 및 recombinant expression으로 신뢰성 확보. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제. Human, Mouse, Rat 종에서 반응 확인됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ENKUR Antibody
enkurin, TRPC channel interacting protein
Recommended Applications
IHC (Orthogonal validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Recombinant expression validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human ENKUR
Alternative Gene Names
C10orf63, CFAP106, enkurin, MGC26778
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | enkurin, TRPC channel interacting protein |
| Target Gene | ENKUR |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PAVPLKTDHPVMGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKDYGVTPEYICKRNEE |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000026679 (92%), Rat ENSRNOG00000018631 (87%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ENKUR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ENKUR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ENKUR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ENKD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ENDOU Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|