Atlas Antibodies Anti-SLC9A1 Antibody

상품 한눈에 보기

Human SLC9A1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 정교한 정합 검증 수행. 고순도 Affinity 정제 방식으로 제조되며, 다양한 조직 발현 분석에 적합. 40% 글리세롤 및 PBS 완충액 포함.

카탈로그번호: HPA052891-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA052891-100 Anti-SLC9A1 Antibody, solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA052891-25 Anti-SLC9A1 Antibody, solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC9A1 Antibody

Anti-SLC9A1 Antibody

Target: solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human SLC9A1.

Alternative Gene Names

APNH, NHE1, PPP1R143

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1
Target Gene	SLC9A1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KILRNNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITIDPA

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000007982 (97%)
Mouse ENSMUSG00000028854 (96%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet