CacheBy
Atlas Antibodies Anti-SLC9A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC9A1 Antibody

상품 한눈에 보기

Human SLC9A1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 단백질 발현 분석에 적합. RNA-seq 기반 정교한 Orthogonal 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA048532-100 Anti-SLC9A1 Antibody, solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048532-25 Anti-SLC9A1 Antibody, solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC9A1 Antibody

Anti-SLC9A1 Antibody

solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SLC9A1


Alternative Gene Names

APNH, NHE1, PPP1R143

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1
Target Gene SLC9A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KILRNNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITIDPA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000007982 (97%)
  • Mouse ENSMUSG00000028854 (96%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.