CacheBy
Atlas Antibodies Anti-SLC8A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC8A1 Antibody

상품 한눈에 보기

Human SLC8A1 단백질을 인식하는 Rabbit Polyclonal 항체로, sodium/calcium exchanger 연구에 적합. Affinity purified 방식으로 높은 특이도와 재현성을 제공. Human에 반응하며, ICC 등 다양한 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA070007-100 Anti-SLC8A1 Antibody, solute carrier family 8 (sodium/calcium exchanger), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070007-25 Anti-SLC8A1 Antibody, solute carrier family 8 (sodium/calcium exchanger), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC8A1 Antibody

Anti-SLC8A1 Antibody

Target: solute carrier family 8 (sodium/calcium exchanger), member 1
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SLC8A1.


Alternative Gene Names

  • NCX1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 8 (sodium/calcium exchanger), member 1
Target Gene SLC8A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse ENSMUSG00000054640 (93%)
  • Rat ENSRNOG00000008479 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.