CacheBy
Atlas Antibodies Anti-SLC8A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC8A2 Antibody

상품 한눈에 보기

Human SLC8A2 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC Orthogonal Validation 완료. Recombinant PrEST 항원을 이용한 Affinity 정제. Human에 반응하며 Rat 및 Mouse와 높은 서열 일치율을 가짐. 연구용으로 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA054671-100 Anti-SLC8A2 Antibody, solute carrier family 8 (sodium/calcium exchanger), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054671-25 Anti-SLC8A2 Antibody, solute carrier family 8 (sodium/calcium exchanger), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC8A2 Antibody

Anti-SLC8A2 Antibody

solute carrier family 8 (sodium/calcium exchanger), member 2

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SLC8A2

Alternative Gene Names

  • KIAA1087
  • NCX2

Open Datasheet

Target Information

항목 내용
Target Protein solute carrier family 8 (sodium/calcium exchanger), member 2
Target Gene SLC8A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PANDSDTSTGGCQGSYRCQPGVLLPVWEPDDPSLGDKAA
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000001492 (95%), Mouse ENSMUSG00000030376 (85%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.