
Atlas Antibodies Anti-SLC7A7 Antibody
Human SLC7A7 단백질을 인식하는 폴리클로날 토끼 항체. IHC 및 WB에서 검증된 제품으로, PrEST 항원으로 정제됨. 인간 반응성 확인 및 교차종 정보 제공. 안정적 보존용 버퍼 포함.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC7A7 Antibody
Target: solute carrier family 7 (amino acid transporter light chain, y+L system), member 7
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Recombinant expression validation (WB)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human SLC7A7
Alternative Gene Names
LPI, y+LAT-1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 |
| Target Gene | SLC7A7 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000000958 (68%), Rat ENSRNOG00000010296 (58%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC7A9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC7A8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC7A7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC7A6OS Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC7A6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|