CacheBy
Atlas Antibodies Anti-SLC7A7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC7A7 Antibody

상품 한눈에 보기

Human SLC7A7 단백질을 인식하는 폴리클로날 토끼 항체. IHC 및 WB에서 검증된 제품으로, PrEST 항원으로 정제됨. 인간 반응성 확인 및 교차종 정보 제공. 안정적 보존용 버퍼 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036227-100 Anti-SLC7A7 Antibody, solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036227-25 Anti-SLC7A7 Antibody, solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC7A7 Antibody

Anti-SLC7A7 Antibody

Target: solute carrier family 7 (amino acid transporter light chain, y+L system), member 7
Supplier: Atlas Antibodies


  • Orthogonal validation (IHC)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • Recombinant expression validation (WB)
    Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human SLC7A7

Alternative Gene Names

LPI, y+LAT-1

Open Datasheet


Specifications

항목 내용
Target Protein solute carrier family 7 (amino acid transporter light chain, y+L system), member 7
Target Gene SLC7A7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000000958 (68%), Rat ENSRNOG00000010296 (58%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.