Atlas Antibodies Anti-SLC7A3 Antibody
상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA003629-100 | - | Atlas Antibodies HPA003629-100 Anti-SLC7A3 Antibody, solute carrier family 7 (cationic amino acid transporter, y+ system), member 3 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA003629-25 | - | Atlas Antibodies HPA003629-25 Anti-SLC7A3 Antibody, solute carrier family 7 (cationic amino acid transporter, y+ system), member 3 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-SLC7A3 Antibody
solute carrier family 7 (cationic amino acid transporter, y+ system), member 3
Recommended Applications
Product Description
Polyclonal Antibody against Human SLC7A3
Alternative Gene Names
ATRC3, CAT-3, FLJ14541
Target Protein
solute carrier family 7 (cationic amino acid transporter, y+ system), member 3
Target Gene
SLC7A3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
RYQPDQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQI
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000004133 (71%)
Mouse ENSMUSG00000031297 (65%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|