
Atlas Antibodies Anti-SLC44A4 Antibody
상품 한눈에 보기
Human SLC44A4 단백질에 특이적인 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC Orthogonal Validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. Affinity purification 방식으로 고순도 확보, 다양한 조직 발현 연구에 적합합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC44A4 Antibody
Target: solute carrier family 44, member 4 (SLC44A4)
Type: Polyclonal Antibody against Human SLC44A4
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody generated in rabbit against human SLC44A4.
Alternative Gene Names
C6orf29, CTL4, FLJ14491, NG22, TPPT
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RQVLYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGV
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000007034 | 75% |
| Rat | ENSRNOG00000000878 | 71% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험에 따라 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC45A4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC45A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC44A4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC44A5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC44A3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.