CacheBy
Atlas Antibodies Anti-SLC30A6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC30A6 Antibody

상품 한눈에 보기

Human SLC30A6 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원으로 친화 정제됨. 면역세포화학(ICC) 등에 적합하며, 인간에 대해 검증됨. 40% 글리세롤과 PBS 완충액에 보존제 포함.

카탈로그번호
HPA055032-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055032-100 Anti-SLC30A6 Antibody, solute carrier family 30 (zinc transporter), member 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055032-25 Anti-SLC30A6 Antibody, solute carrier family 30 (zinc transporter), member 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC30A6 Antibody

Anti-SLC30A6 Antibody

Target: solute carrier family 30 (zinc transporter), member 6
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against Human SLC30A6.

Alternative Gene Names

FLJ31101, ZNT6

  • Immunocytochemistry (ICC)

Target Information

항목 내용
Target Protein solute carrier family 30 (zinc transporter), member 6
Target Gene SLC30A6
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000005856 (89%), Mouse ENSMUSG00000024069 (89%)

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVT

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.