
Atlas Antibodies Anti-SLC30A1 Antibody
Human SLC30A1(ZNT1) 단백질을 표적하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 정제됨. 높은 종 특이성과 안정적인 IgG 아이소타입. 40% 글리세롤/PBS 버퍼에 나트륨 아지드 보존제 포함.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC30A1 Antibody
Target: solute carrier family 30 (zinc transporter), member 1
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human SLC30A1.
Alternative Gene Names
- ZNT1
- ZRC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 30 (zinc transporter), member 1 |
| Target Gene | SLC30A1 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000004749 (66%), Mouse ENSMUSG00000110850 (64%) |
Antigen Information
Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
HHSGFSQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLDPADPENPRSGDTVEVQVNGNLVREPDHMELEEDRAGQLNMRGV
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC30A10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC30A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC30A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC2A9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC30A1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|