CacheBy
Atlas Antibodies Anti-SLC30A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC30A1 Antibody

상품 한눈에 보기

Human SLC30A1(ZNT1) 단백질을 표적하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 정제됨. 높은 종 특이성과 안정적인 IgG 아이소타입. 40% 글리세롤/PBS 버퍼에 나트륨 아지드 보존제 포함.

카탈로그번호
HPA015275-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015275-100 Anti-SLC30A1 Antibody, solute carrier family 30 (zinc transporter), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015275-25 Anti-SLC30A1 Antibody, solute carrier family 30 (zinc transporter), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC30A1 Antibody

Anti-SLC30A1 Antibody

Target: solute carrier family 30 (zinc transporter), member 1
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SLC30A1.

Alternative Gene Names

  • ZNT1
  • ZRC1

Open Datasheet

Target Information

항목 내용
Target Protein solute carrier family 30 (zinc transporter), member 1
Target Gene SLC30A1
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004749 (66%), Mouse ENSMUSG00000110850 (64%)

Antigen Information

Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
HHSGFSQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLDPADPENPRSGDTVEVQVNGNLVREPDHMELEEDRAGQLNMRGV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.