CacheBy
Atlas Antibodies Anti-SLC2A3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC2A3 Antibody

상품 한눈에 보기

Human SLC2A3(GLUT3) 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit 유래 IgG 형식으로 제작되었으며, IHC 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA006539-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006539-100 Anti-SLC2A3 Antibody, solute carrier family 2 (facilitated glucose transporter), member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006539-25 Anti-SLC2A3 Antibody, solute carrier family 2 (facilitated glucose transporter), member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC2A3 Antibody

Anti-SLC2A3 Antibody

Target: solute carrier family 2 (facilitated glucose transporter), member 3
Alternative Gene Name: GLUT3
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SLC2A3 (GLUT3).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.


Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000003153 65%
Rat ENSRNOG00000008376 64%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Recommended Applications IHC, ICC

Material Safety Data Sheet (MSDS)
Open Datasheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.