CacheBy
Atlas Antibodies Anti-SLC2A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC2A2 Antibody

상품 한눈에 보기

Human SLC2A2(GLUT2) 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. RNA-seq 데이터 기반의 정교한 직교 검증이 수행되었으며, 고순도의 Affinity Purified 제품입니다.

카탈로그번호
HPA028997-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028997-100 Anti-SLC2A2 Antibody, solute carrier family 2 (facilitated glucose transporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028997-25 Anti-SLC2A2 Antibody, solute carrier family 2 (facilitated glucose transporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC2A2 Antibody

Anti-SLC2A2 Antibody

Target: solute carrier family 2 (facilitated glucose transporter), member 2
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human SLC2A2.


Alternative Gene Names

  • GLUT2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 2 (facilitated glucose transporter), member 2
Target Gene SLC2A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATET
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000011875 (77%), Mouse ENSMUSG00000027690 (74%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.