CacheBy
Atlas Antibodies Anti-SLC2A5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC2A5 Antibody

상품 한눈에 보기

Human SLC2A5(Glucose/Fructose transporter GLUT5)에 대한 Rabbit Polyclonal Antibody. IHC 및 Western blot 검증 완료. Recombinant PrEST 항원으로 정제. 인간 반응성 확인 및 설치류와 높은 서열 유사성 보유.

카탈로그번호
HPA075145-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA075145-100 Anti-SLC2A5 Antibody, solute carrier family 2 member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075145-25 Anti-SLC2A5 Antibody, solute carrier family 2 member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC2A5 Antibody

Anti-SLC2A5 Antibody

solute carrier family 2 (facilitated glucose/fructose transporter), member 5


  • IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human SLC2A5


Alternative Gene Names

  • GLUT5

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 2 (facilitated glucose/fructose transporter), member 5
Target Gene SLC2A5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQ
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000017693 (83%), Mouse ENSMUSG00000028976 (76%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.